PDB entry 4q1y

View 4q1y on RCSB PDB site
Description: Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, AIDS, inhibitor complex, hydrolase-hydrolase inhibitor complex
Deposited on 2014-04-04, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aspartyl protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot V5Y949 (0-98)
    • engineered mutation (6)
    • engineered mutation (31-32)
  Domains in SCOPe 2.08: d4q1ya_
• Chain 'B':
  Compound: Aspartyl protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot V5Y949 (0-98)
    • engineered mutation (6)
    • engineered mutation (31-32)
  Domains in SCOPe 2.08: d4q1yb_
• Heterogens: PO4, ACT, 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4q1yA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtifeemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4q1yB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtifeemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf