PDB entry 4q1y

View 4q1y on RCSB PDB site
Description: Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, AIDS, inhibitor complex, hydrolase-hydrolase inhibitor complex
Deposited on 2014-04-04, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartyl protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5Y949 (0-98)
      • engineered mutation (6)
      • engineered mutation (31-32)
    Domains in SCOPe 2.08: d4q1ya_
  • Chain 'B':
    Compound: Aspartyl protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5Y949 (0-98)
      • engineered mutation (6)
      • engineered mutation (31-32)
    Domains in SCOPe 2.08: d4q1yb_
  • Heterogens: PO4, ACT, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q1yA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtifeemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q1yB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtifeemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf