PDB entry 4q1l

View 4q1l on RCSB PDB site
Description: Crystal structure of Leucurolysin-a complexed with an endogenous tripeptide (QSW).
Class: hydrolase
Keywords: Alfa/Beta Protein, Metalloendopeptidase, Zinc Binding Calcium Binding, Venom Compound, HYDROLASE
Deposited on 2014-04-03, released 2015-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snake venom metalloproteinase leucurolysin-A
    Species: Bothrops leucurus [TaxId:157295]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84907 (0-201)
      • see remark 999 (101-102)
    Domains in SCOPe 2.08: d4q1la_
  • Chain 'D':
    Compound: gln-ser-trp
    Species: Bothrops leucurus [TaxId:157295]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q1L (0-2)
  • Heterogens: CA, ZN, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4q1lA (A:)
qqfspryielvvvadhgmfkkynsnlntirkwvhemlntvngffrsmnvdaslvnlevws
kkdlikvekdssktltsfgewrerdllprishdhaqlltvivfdeetigiaytagmcdls
qsvavvmdhskknlrvavtmahelghnlgmrhdgnqchcnapscimadtlskglsfefsd
csqnqyqtyltkhnpqcilnkp

  • Chain 'D':
    No sequence available.