PDB entry 4q0k

View 4q0k on RCSB PDB site
Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)
Class: hormone binding protein
Keywords: cytokinin-specific binding protein (csbp), pr-10 fold, plant hormone binding, gibberellin, hormone binding protein
Deposited on 2014-04-02, released 2014-04-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.124
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytohormone binding protein mtphbp
    Species: Medicago truncatula [TaxId:3880]
    Gene: mtphbp, MTR_3g055120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q0ka_
  • Heterogens: GA3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4q0kA (A:)
gidpftmikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtkl
ifnflpgiapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktl
vnvkisydheselieekvkptktsestlfylgqlekfllnga

    Sequence, based on observed residues (ATOM records): (download) 
    >4q0kA (A:)
mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
ydheselieekvkptktsestlfylgqlekflln