PDB entry 4q02

View 4q02 on RCSB PDB site
Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
Class: hydrolase
Keywords: small GTPase, signaling transduction, Sos, Raf, cytosol, HYDROLASE
Deposited on 2014-03-31, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (39)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d4q02a1, d4q02a2
  • Heterogens: GDP, MG, 2XG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q02A (A:)
    gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek