PDB entry 4q01

View 4q01 on RCSB PDB site
Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
Class: hydrolase
Keywords: small GTPase, signaling transduction, Sos, Raf, cytosol, HYDROLASE
Deposited on 2014-03-31, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.189
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: K-Ras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-End)
      • engineered mutation (11)
      • engineered mutation (38)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d4q01a_
  • Chain 'B':
    Compound: K-Ras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-168)
      • engineered mutation (11)
      • engineered mutation (38)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d4q01b_
  • Heterogens: GDP, MG, 2XH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q01A (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q01A (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q01B (B:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek