PDB entry 4pzy
View 4pzy on RCSB PDB site
Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
Class: hydrolase
Keywords: small GTPase, signaling transduction, SOS, Raf, cytosol, HYDROLASE
Deposited on
2014-03-31, released
2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-09-10, with a file datestamp of
2014-09-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.188
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: K-Ras
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01116 (1-169)
- expression tag (0)
- engineered mutation (12)
- engineered mutation (70)
- engineered mutation (118)
Domains in SCOPe 2.07: d4pzya1, d4pzya2 - Chain 'B':
Compound: K-Ras
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01116 (1-169)
- expression tag (0)
- engineered mutation (12)
- engineered mutation (70)
- engineered mutation (118)
Domains in SCOPe 2.07: d4pzyb1, d4pzyb2 - Heterogens: GDP, MG, 2XR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4pzyA (A:)
gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4pzyB (B:)
gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek