PDB entry 4pzy

View 4pzy on RCSB PDB site
Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
Class: hydrolase
Keywords: small GTPase, signaling transduction, SOS, Raf, cytosol, HYDROLASE
Deposited on 2014-03-31, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: K-Ras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (70)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d4pzya1, d4pzya2
  • Chain 'B':
    Compound: K-Ras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (70)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d4pzyb1, d4pzyb2
  • Heterogens: GDP, MG, 2XR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pzyA (A:)
    gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pzyB (B:)
    gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek