PDB entry 4pzd

View 4pzd on RCSB PDB site
Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 in complex with NAD+
Class: oxidoreductase
Keywords: Rossmann Fold, OXIDOREDUCTASE
Deposited on 2014-03-29, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.202
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzda1, d4pzda2
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdb1, d4pzdb2
  • Chain 'C':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdc1, d4pzdc2
  • Chain 'D':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdd1, d4pzdd2
  • Chain 'E':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzde1, d4pzde2
  • Chain 'F':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdf1, d4pzdf2
  • Chain 'G':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdg1, d4pzdg2
  • Chain 'H':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdh1, d4pzdh2
  • Chain 'I':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Ralstonia eutropha H16 [TaxId:381666]
    Gene: paaH1, H16_A0282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pzdi1, d4pzdi2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pzdA (A:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdA (A:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pzdB (B:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdB (B:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pzdC (C:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdC (C:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pzdD (D:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdD (D:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pzdE (E:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdE (E:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pzdF (F:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdF (F:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4pzdG (G:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdG (G:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4pzdH (H:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdH (H:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4pzdI (I:)
    msirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklt
    eadkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntss
    isitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypit
    vknspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtm
    lavmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pzdI (I:)
    sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
    adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
    sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
    knspgfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtml
    avmevlytefadpkyrpamlmremvaagylgrktgrgvyvysk