PDB entry 4py8

View 4py8 on RCSB PDB site
Description: Crystal structure of Fab 3.1 in complex with the 1918 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: hemagglutinin glycoproteins, immunoglobulin Fab fragment, membrane fusion, neutralizing antibodies, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-03-26, released 2014-05-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.196
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:59375]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.05: d4py8a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:59375]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4py8b_
  • Chain 'I':
    Compound: antibody 3.1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PY8 (0-218)
  • Chain 'J':
    Compound: antibody 3.1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PY8 (0-End)
    Domains in SCOPe 2.05: d4py8j1, d4py8j2
  • Heterogens: NAG, MLI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4py8A (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4py8A (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4py8B (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4py8B (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlyekv
    ksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4py8J (J:)
    elqmtqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqansfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4py8J (J:)
    elqmtqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqansfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg