PDB entry 4pxj

View 4pxj on RCSB PDB site
Description: crystallographic structure of the lzii fragment (anti-parallel orientation) from jip3
Deposited on 2014-03-24, released 2015-06-10
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-Jun-amino-terminal kinase-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8IP3, JIP3, KIAA1066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPT6 (7-End)
      • expression tag (4-6)
  • Chain 'B':
    Compound: C-Jun-amino-terminal kinase-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8IP3, JIP3, KIAA1066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPT6 (7-60)
      • expression tag (4-6)
  • Chain 'C':
    Compound: C-Jun-amino-terminal kinase-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8IP3, JIP3, KIAA1066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPT6 (7-60)
      • expression tag (0-6)
  • Heterogens: SO4, EDO, GAI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4pxjA (A:)
gamdpeftknalnvvkndliakvdqlsgeqevlrgeleaakqakvklenrikeleeelkr
v

    Sequence, based on observed residues (ATOM records):
    >4pxjA (A:)
peftknalnvvkndliakvdqlsgeqevlrgeleaakqakvklenrikeleeelkr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4pxjB (B:)
gamdpeftknalnvvkndliakvdqlsgeqevlrgeleaakqakvklenrikeleeelkr
v

    Sequence, based on observed residues (ATOM records):
    >4pxjB (B:)
peftknalnvvkndliakvdqlsgeqevlrgeleaakqakvklenrikeleeelkrv

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4pxjC (C:)
gamdpeftknalnvvkndliakvdqlsgeqevlrgeleaakqakvklenrikeleeelkr
v