PDB entry 4px6

View 4px6 on RCSB PDB site
Description: SYK catalytic domain in complex with a potent pyridopyrimidinone inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase domain, phosphotransferase, transferase-transferase inhibitor complex
Deposited on 2014-03-21, released 2014-04-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • engineered mutation (114)
      • expression tag (283)
    Domains in SCOPe 2.04: d4px6a_
  • Heterogens: 2X6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4px6A (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4px6A (A:)
    yldrklltledkelgsgnfgtvkkgyyqmvvktvavkilkpalkdellaeanvmqqldnp
    yivrmigiceaeswmlvmemaelgplnkylqqnrhvtdkniielvhqvsmgmkyleesnf
    vhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfssksd
    vwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydve
    nrpgfaavelrlrnyyydvvne