PDB entry 4pwz

View 4pwz on RCSB PDB site
Description: Crystal structure of TolB protein from Yersinia pestis CO92
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta fold and beta propeller fold, translocation, Pal, PROTEIN TRANSPORT
Deposited on 2014-03-21, released 2014-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tolb
    Species: Yersinia pestis [TaxId:214092]
    Gene: tolB, y3055, YPO1124, YP_1032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pwza1, d4pwza2
  • Chain 'B':
    Compound: protein tolb
    Species: Yersinia pestis [TaxId:214092]
    Gene: tolB, y3055, YPO1124, YP_1032
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZGZ1 (4-411)
      • expression tag (3)
    Domains in SCOPe 2.07: d4pwzb1, d4pwzb2, d4pwzb3
  • Heterogens: PEG, GOL, MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pwzA (A:)
    snamvrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpq
    qpstaaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtk
    qwlrysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrs
    peplmspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtkl
    afalsksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvn
    inggvpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtllde
    tpsiapngtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwzA (A:)
    vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
    aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
    ysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrspepl
    mspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtklafal
    sksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvningg
    vpqritwegsqnqnadvspdgkflvlvssaqhiakqdletgavqvltdtlldetpsiapn
    gtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pwzB (B:)
    snamvrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpq
    qpstaaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtk
    qwlrysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrs
    peplmspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtkl
    afalsksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvn
    inggvpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtllde
    tpsiapngtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwzB (B:)
    mvrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqps
    taaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwl
    rysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrspep
    lmspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtklafa
    lsksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvning
    gvpqritwegsqnqnadvspdgkflvlvssaqhiakqdletgavqvltdtlldetpsiap
    ngtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl