PDB entry 4pwt

View 4pwt on RCSB PDB site
Description: Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
Class: membrane protein
Keywords: peptidoglycan-associated outer membrane lipoprotein, alpha-beta fold, Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, MEMBRANE PROTEIN
Deposited on 2014-03-21, released 2014-04-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan-associated lipoprotein
    Species: Yersinia pestis [TaxId:214092]
    Gene: excC, pal, y3054, YPO1125, YP_1031
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pwta_
  • Chain 'B':
    Compound: peptidoglycan-associated lipoprotein
    Species: Yersinia pestis [TaxId:214092]
    Gene: excC, pal, y3054, YPO1125, YP_1031
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pwtb_
  • Chain 'C':
    Compound: peptidoglycan-associated lipoprotein
    Species: Yersinia pestis [TaxId:214092]
    Gene: excC, pal, y3054, YPO1125, YP_1031
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pwtc_
  • Heterogens: SO4, FMT, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pwtA (A:)
    snatengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdk
    vvveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaa
    faknrravlvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwtA (A:)
    natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv
    vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf
    aknrravlvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pwtB (B:)
    snatengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdk
    vvveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaa
    faknrravlvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwtB (B:)
    natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv
    vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf
    aknrravlvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pwtC (C:)
    snatengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdk
    vvveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaa
    faknrravlvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwtC (C:)
    nlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvveghad
    ergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrrav
    lvy