PDB entry 4pwo

View 4pwo on RCSB PDB site
Description: crystal structure of dsba from the gram positive bacterium corynebacterium diphtheriae
Deposited on 2014-03-21, released 2015-03-25
The last revision was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsba
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PWO (0-249)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4pwoA (A:)
tqaektatdlppgfsgkagsvnatpgtkgldgptpladgsfdatifgpakelksaddiln
vhrrnakdpfavgavdaplvitefsdfecpfcarwsnqteptlmeeyvskglvriewndl
pvngehalaaakagraaaaqgkfdefrkalfeasrnvsghpnntlkdferfarnagvkdm
erfsreaqdstydevlakaadyahglgvsgtpafvvgtqyisgaqpteefikvieselkk
sptfstpssh