PDB entry 4pwl

View 4pwl on RCSB PDB site
Description: Crystal structure of the complex between PPARgamma-LBD and the S enantiomer of Mbx-102 (Metaglidasen)
Class: transcription
Keywords: ALPHA-HELICES, SMALL FOUR-STRANDED BETA-SHEET, ACTIVATOR, DNA-BINDING, NUCLEUS, OBESITY, RECEPTOR, TRANSCRIPTION, TRANSCRIPTION REGULATION X-RAY DIFFRACTION, Transcription Factor, RXR-alpha
Deposited on 2014-03-20, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pwla_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pwlb_
  • Heterogens: MSZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pwlA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwlA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkievai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pwlB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwlB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgll
    nvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktet
    dmslhpllqeiy