PDB entry 4pwf

View 4pwf on RCSB PDB site
Description: Crystal structure of V30M mutant human transthyretin complexed with ferulic acid phenethyl ester
Class: transport protein
Keywords: Tranporter, thyroxine binding, TRANSPORT PROTEIN
Deposited on 2014-03-20, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d4pwfa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d4pwfb_
  • Heterogens: PWF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pwfA (A:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwfA (A:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pwfB (B:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pwfB (B:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt