PDB entry 4pw7

View 4pw7 on RCSB PDB site
Description: structure of UHRF2-SRA in complex with a 5mC-containing DNA
Class: ligase/DNA
Keywords: SRA, 5hmC binding, 5hmC-containing DNA, methylation, nuclear, LIGASE-DNA complex
Deposited on 2014-03-19, released 2014-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2, NIRF, RNF107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pw7a_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2, NIRF, RNF107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pw7b_
  • Chain 'C':
    Compound: 5mC-containing DNA1
  • Chain 'D':
    Compound: 5mC-containing DNA2
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2, NIRF, RNF107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pw7e_
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2, NIRF, RNF107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pw7f_
  • Chain 'G':
    Compound: 5mC-containing DNA1
  • Chain 'H':
    Compound: 5mC-containing DNA2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pw7A (A:)
    stesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvggi
    hgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnrala
    lncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpeis
    sshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pw7A (A:)
    ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
    rgdeftytgsggkkrigapsadqtltnmnralalncdaplddkigaesrnwragkpvrvi
    rsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegi
    ersrrlclrlqypagyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pw7B (B:)
    stesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvggi
    hgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnrala
    lncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpeis
    sshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pw7B (B:)
    ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
    rgdeftytgsgsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgrki
    skyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrlcl
    rlqypagyp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pw7E (E:)
    stesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvggi
    hgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnrala
    lncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpeis
    sshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pw7E (E:)
    ctivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfade
    vdrgdeftytgsggkrigapsadqtltnmnralalncdaplddkigaesrnwragkpvrv
    irsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtseg
    iersrrlclrlqypagyp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pw7F (F:)
    stesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvggi
    hgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnrala
    lncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpeis
    sshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pw7F (F:)
    ctivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfade
    vdrgdeftytgsgsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgr
    kiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrl
    clrlqypagyp
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.