PDB entry 4pw4

View 4pw4 on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with phosphonic acid analogue of homophenylalanine L-(R)-hPheP
Class: hydrolase/hydrolase inhibitor
Keywords: APN, aminopeptidase N, complex with inhibitor, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-03-18, released 2014-06-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.158
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: pepN, NMB1416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pw4a1, d4pw4a2, d4pw4a3, d4pw4a4
  • Heterogens: 2X0, ZN, IMD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pw4A (A:)
    msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv
    kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg
    frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps
    ylfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgle
    ydldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwt
    gnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpv
    rpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraa
    madanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvk
    vgllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnyp
    ysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisd
    dlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaak
    qenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavng
    nesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnka
    rsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknl
    vkqalqriraqeglskdvgeivgkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pw4A (A:)
    ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
    ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
    kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
    falvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleyd
    ldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgn
    rvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrp
    asyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraama
    danginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvg
    llnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypys
    dddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddl
    ldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqe
    nqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngne
    sdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkars
    ligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvk
    qalqriraqeglskdvgeivgkild