PDB entry 4pvn

View 4pvn on RCSB PDB site
Description: Neutron structure of human transthyretin (TTR) at room temperature to 2.3A resolution (monochromatic)
Class: transport protein
Keywords: beta sandwich, transport protein, serum
Deposited on 2014-03-18, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: NEUT+
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pvna_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pvnb_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pvnA (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvnA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pvnB (B:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvnB (B:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp