PDB entry 4pvd

View 4pvd on RCSB PDB site
Description: Crystal structure of yeast methylglyoxal/isovaleraldehyde reductase Gre2 complexed with NADPH
Class: oxidoreductase
Keywords: Rossmann fold, Reductase, NADPH binding, OXIDOREDUCTASE
Deposited on 2014-03-17, released 2014-10-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH-dependent methylglyoxal reductase GRE2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GRE2, YOL151W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pvda_
  • Chain 'B':
    Compound: NADPH-dependent methylglyoxal reductase GRE2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GRE2, YOL151W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pvdb_
  • Chain 'C':
    Compound: NADPH-dependent methylglyoxal reductase GRE2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GRE2, YOL151W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pvdc_
  • Chain 'D':
    Compound: NADPH-dependent methylglyoxal reductase GRE2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GRE2, YOL151W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pvdd_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pvdA (A:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
    rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
    eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
    dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
    hntlgatldnkkskkllgfkfrnlketiddtasqilkfegri
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pvdB (B:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
    rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
    eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
    dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
    hntlgatldnkkskkllgfkfrnlketiddtasqilkfegri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pvdC (C:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
    rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
    eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
    dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
    hntlgatldnkkskkllgfkfrnlketiddtasqilkfegri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvdC (C:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtasplipavngvkgilhsikkyaadsvervvltssyaavf
    dmakendksltfneeswnpatkkfaekaawefleenrdsvkfeltavnpvyvfgpqmfdk
    dvkkelvnslmhlspedkipelfggyidvrdvakahlvafqkretigqrlivsearftmq
    dvldilnedfpvlkgnipvgkpgsgathntlgatldnkkskkllgfkfrnlketiddtas
    qilkfegr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pvdD (D:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
    rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
    eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
    dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
    hntlgatldnkkskkllgfkfrnlketiddtasqilkfegri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvdD (D:)
    msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
    ldafdhvfqkhgkdikivlhtaspllipavngvkgilhsikkyaadsvervvltssyaav
    fdkendksltfnnpatskkfaekaawefleenrdsvkfeltavnpvyvfgpqmfdkdvkk
    celvnslmhlspedkipelfggyidvrdvakahlvafqkretigqrlivsearftmqdvl
    dilnedfpvlkgnipvgkpgsgathntlgatldnkkskkllgfkfrnlketiddtasqil
    kfegr