PDB entry 4pvb

View 4pvb on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with the phosphonic acid analogue of leucine (D-(S)-LeuP)
Class: hydrolase
Keywords: APN, aminopeptidase N, D-(S)-LeuP, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, hydrolase
Deposited on 2014-03-16, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: pepN, NMB1416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pvba1, d4pvba2, d4pvba3, d4pvba4
  • Heterogens: 2WW, ZN, SO4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pvbA (A:)
    msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv
    kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg
    frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps
    ylfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgle
    ydldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwt
    gnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpv
    rpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraa
    madanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvk
    vgllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnyp
    ysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisd
    dlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaak
    qenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavng
    nesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnka
    rsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknl
    vkqalqriraqeglskdvgeivgkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvbA (A:)
    tvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkin
    gaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrk
    itfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylf
    alvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydl
    difmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnr
    vtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpa
    syeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamad
    anginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgl
    lnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypysd
    ddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddll
    dnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqen
    qsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngnes
    dtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkarsl
    igsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvkq
    alqriraqeglskdvgeivgkild