PDB entry 4pv1

View 4pv1 on RCSB PDB site
Description: Cytochrome B6F structure from M. laminosus with the quinone analog inhibitor stigmatellin
Class: electron transport/inhibitor
Keywords: alpha helix, beta sheet, plastoquinol:plastocyanin oxidoreductase, plastocyanin, thylakoid membrane, electron transport-inhibitor complex
Deposited on 2014-03-14, released 2014-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1a_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1b_
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83793 (0-End)
      • conflict (10)
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1d1, d4pv1d2
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1e_
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1f_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1g_
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pv1h_
  • Heterogens: MYS, CD, HEM, UMQ, SMA, 7PH, 8K6, CLA, OPC, FES, SQD, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pv1A (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1A (A:)
    nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv
    teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv
    ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr
    yysahtfvlpwliavfmllhflmirkqgisgpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pv1B (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1B (B:)
    atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam
    vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq
    npfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pv1D (D:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1D (D:)
    dvpdmgrrqfmnllafgtvtgvalgalyplvkyfippstakdklgnnvkvskfleshnag
    drvlvqglkgdptyivairdyginavcthlgcvvpwnaaenkfkcpchgsqydetgkvir
    gpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pv1E (E:)
    milgavfyivfialffgiavgiifaiksikli
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1E (E:)
    ilgavfyivfialffgiavgiifaiksi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pv1F (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1F (F:)
    teemlyaallsfglifvgwglgvlllkiqga
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pv1G (G:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4pv1H (H:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv1H (H:)
    eidvlgwvallvvftwsiamvvwgrngl