PDB entry 4pv0

View 4pv0 on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase (Syk) in complex with an imidazopyrazine inhibitor
Class: transferase/transferase inhibitor
Keywords: Syk, spleen tyrosine kinase, kinase inhibitor, protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-03-14, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (0-272)
      • expression tag (273-274)
    Domains in SCOPe 2.07: d4pv0a1, d4pv0a2
  • Heterogens: CG4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pv0A (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pv0A (A:)
    vyldrklltledkelgsfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykf
    ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
    tydvenrpgfaavelrlrnyyydvvneg