PDB entry 4puz

View 4puz on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase (Syk) in complex with GS-9973
Class: transferase/transferase inhibitor
Keywords: Syk, spleen tyrosine kinase, kinase inhibitor, Protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-03-14, released 2014-04-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4puza_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4puzb_
  • Heterogens: CG9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4puzA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4puzA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykaqkwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4puzB (B:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4puzB (B:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykaqkwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvn