PDB entry 4pu9

View 4pu9 on RCSB PDB site
Description: E. coli GyrB 43-kDa N-terminal fragment in complex with ADP-BeF3
Class: isomerase
Keywords: GyrB, ATP hydrolysis, ISOMERASE
Deposited on 2014-03-12, released 2014-09-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GyrB
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pu9a1, d4pu9a2
  • Heterogens: ADP, BEF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pu9A (A:)
    mhhhhhhsnsydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealag
    hckeiivtihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgg
    lhgvgvsvvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsle
    tftnvtefeyeilakrlrelsflnsgvsirlrdkrdgkedhfhyeggikafveylnknkt
    pihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtln
    aymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmn
    ellaeyllenptdakivvgkiidaarareaarraremt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pu9A (A:)
    sydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivti
    hadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvv
    nalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefe
    yeilakrlrelsflnsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnifyf
    stekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkegys
    kregliavvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyllenptdakivvgk
    iidaarareaarra