PDB entry 4pu8

View 4pu8 on RCSB PDB site
Description: shewanella oneidensis toxin antitoxin system antitoxin protein hipb resolution 2.35
Deposited on 2014-03-12, released 2014-08-06
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin-antitoxin system antidote transcriptional repressor Xre family
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: Shewmr4_3396, SO_0705
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EIX4 (40-End)
      • expression tag (36-39)
  • Chain 'B':
    Compound: Toxin-antitoxin system antidote transcriptional repressor Xre family
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: Shewmr4_3396, SO_0705
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EIX4 (40-End)
      • expression tag (36-39)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4pu8A (A:)
mgsshhhhhhssglvprgshmmngtdikakvyedtlletimasplnqqslgllikerrks
aaltqdvaamlcgvtkktlirvekgedvyistvfkildglgidivsaqtsdtetngwy

    Sequence, based on observed residues (ATOM records):
    >4pu8A (A:)
letimasplnqqslgllikerrksaaltqdvaamlcgvtkktlirvekgedvyistvfki
ldglgidivsa

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4pu8B (B:)
mgsshhhhhhssglvprgshmmngtdikakvyedtlletimasplnqqslgllikerrks
aaltqdvaamlcgvtkktlirvekgedvyistvfkildglgidivsaqtsdtetngwy

    Sequence, based on observed residues (ATOM records):
    >4pu8B (B:)
letimasplnqqslgllikerrksaaltqdvaamlcgvtkktlirvekgedvyistvfki
ldglgidivsa