PDB entry 4pu2

View 4pu2 on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with the phosphonic acid analogue of leucine L-(R)-LeuP
Class: hydrolase
Keywords: APN, aminopeptidase N, L-(R)-LeuP, PSI-Biology, Structural Genomics, Midwest Center for Structural Genomics, MCSG, hydrolase, aminopeptidase
Deposited on 2014-03-11, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: pepN, NMB1416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pu2a1, d4pu2a2, d4pu2a3, d4pu2a4
  • Heterogens: PLU, GOL, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pu2A (A:)
    msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv
    kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg
    frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps
    ylfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgle
    ydldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwt
    gnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpv
    rpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraa
    madanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvk
    vgllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnyp
    ysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisd
    dlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaak
    qenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavng
    nesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnka
    rsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknl
    vkqalqriraqeglskdvgeivgkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pu2A (A:)
    tvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkin
    gaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrk
    itfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylf
    alvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydl
    difmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnr
    vtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpa
    syeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamad
    anginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgl
    lnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypysd
    ddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddll
    dnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqen
    qsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngnes
    dtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkarsl
    igsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvkq
    alqriraqeglskdvgeivgkild