PDB entry 4ptw

View 4ptw on RCSB PDB site
Description: Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex
Class: hydrolase
Keywords: (beta/alpha)8 fold, TIM barrel, glycoside hydrolase, beta-glucosidase, HYDROLASE
Deposited on 2014-03-11, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 1
    Species: Halothermothrix orenii [TaxId:373903]
    Gene: bgla, Hore_15280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ptwa_
  • Chain 'B':
    Compound: Glycoside hydrolase family 1
    Species: Halothermothrix orenii [TaxId:373903]
    Gene: bgla, Hore_15280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ptwb_
  • Heterogens: G2F, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ptwA (A:)
    smakiifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyh
    lyredielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitl
    yhwdlpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgn
    hapgtkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaa
    sllddyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrm
    vvrhkpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaaf
    ddklteegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgl
    iyvdyengnrrflkdsalwyreviekgqvean
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ptwA (A:)
    iifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhlyre
    dielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyhwd
    lpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnhapg
    tkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaaslld
    dyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvvrh
    kpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaafddkl
    teegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyvd
    yengnrrflkdsalwyreviekgqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ptwB (B:)
    smakiifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyh
    lyredielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitl
    yhwdlpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgn
    hapgtkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaa
    sllddyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrm
    vvrhkpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaaf
    ddklteegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgl
    iyvdyengnrrflkdsalwyreviekgqvean
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ptwB (B:)
    iifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhlyre
    dielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyhwd
    lpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnhapg
    tkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaaslld
    dyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvvrh
    kpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaafddkl
    teegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyvd
    yengnrrflkdsalwyreviekgqv