PDB entry 4ptd

View 4ptd on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c mutant d274n
Deposited on 1997-07-18, released 1998-01-21
The last revision prior to the SCOP 1.71 freeze date was dated 1998-01-21, with a file datestamp of 1998-01-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d4ptd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >4ptd_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqnyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ptd_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqnyinekwspllyqeviranksli