PDB entry 4pt4

View 4pt4 on RCSB PDB site
Description: Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]
Class: DNA binding protein
Keywords: DIMERIZATION BY FOUR HELIX BUNDLE INTERACTION, DNA condensation, DNA-binding, DNA BINDING PROTEIN
Deposited on 2014-03-10, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein HU homolog
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2986c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pt4a_
  • Chain 'B':
    Compound: DNA-binding protein HU homolog
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2986c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pt4b_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pt4A (A:)
    mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
    rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pt4B (B:)
    mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
    rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt4B (B:)
    mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
    rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpa