PDB entry 4pt1

View 4pt1 on RCSB PDB site
Description: Crystal structure of Locusta migratoria odorant binding proteins lmigOBP1
Class: transport protein
Keywords: OBP, odorant perception, TRANSPORT PROTEIN
Deposited on 2014-03-10, released 2014-12-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Odorant-binding protein 1d
    Species: Locusta migratoria [TaxId:7004]
    Gene: lmigobp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pt1a_
  • Chain 'B':
    Compound: Odorant-binding protein 1d
    Species: Locusta migratoria [TaxId:7004]
    Gene: lmigobp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pt1b_
  • Heterogens: PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pt1A (A:)
    mdvnmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefns
    lsddgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelysl
    vvrafdatigd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt1A (A:)
    vnmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefnsls
    ddgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelyslvv
    rafdatigd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pt1B (B:)
    mdvnmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefns
    lsddgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelysl
    vvrafdatigd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt1B (B:)
    nmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefnslsd
    dgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelyslvvr
    afdatigd