PDB entry 4ps8

View 4ps8 on RCSB PDB site
Description: Structure of PI3K gamma in complex with N-[6-(5,6-dimethoxypyridin-3-yl)-1,3-benzothiazol-2-yl]acetamide
Class: transferase/transferase inhibitor
Keywords: serine/threonine protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-03-06, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.197
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PI3K gamma, PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • conflict (316)
    Domains in SCOPe 2.07: d4ps8a1, d4ps8a2, d4ps8a3, d4ps8a4
  • Heterogens: 2WK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ps8A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps8A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakqdfvlrvcg
    rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeewcdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisil
    ldnhpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssv
    kwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
    lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
    leaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqn
    sqlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgd
    dlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstv
    gntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimite
    tgnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnllii
    lfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflh
    lvl