PDB entry 4pqd

View 4pqd on RCSB PDB site
Description: The longer crystal structure of the grow factor like domain from Beta amypoid precusor protein (APP22-126)
Class: protein binding
Keywords: Alphan and Beta, Growth factor, Heparin binding, protein binding, Alzheimer's Disease, Death receptor 6 binding
Deposited on 2014-03-02, released 2015-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4pqda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pqdA (A:)
tdgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelq
itnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefvsda