PDB entry 4pqb

View 4pqb on RCSB PDB site
Description: A sperm whale myoglobin double mutant L29E/F43H Mb with a non-native bis-His (His64/His93) coordination
Class: oxygen transport
Keywords: Structural Genomics, Enzyme Function Initiative, Alpha helix bundle, OXYGEN TRANSPORT
Deposited on 2014-03-01, released 2015-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (29)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d4pqba_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pqbA (A:)
    mvlsegewqlvlhvwakveadvaghgqdieirlfkshpetlekhdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pqbA (A:)
    vlsegewqlvlhvwakveadvaghgqdieirlfkshpetlekhdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg