PDB entry 4pq9

View 4pq9 on RCSB PDB site
Description: Crystal Structure of a Beta-1,3-glucanase from Mycobacterium marinum
Class: hydrolase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Glycosyl hydrolase, hydrolase
Deposited on 2014-02-28, released 2014-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.119
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,3-glucanase
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: MMAR_2902
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pq9a_
  • Chain 'B':
    Compound: Beta-1,3-glucanase
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: MMAR_2902
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pq9b_
  • Heterogens: MG, BTB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pq9A (A:)
    mahhhhhhadssrrdmplapapngqsgpylfhdefdgpagsapdsskwtvarareemkdp
    tywerpenvgqyrddrqnvfldgksnlviraakdggtyyagkiqspwrggightwearik
    fdcltagcwpawwlgnqdrgeidiiewygngswpsattvhakangsewktrnvaldsgwh
    twrcqwdetgmrfwqdyaegaqpyftvaahslpdwpfndpgytvfpvlnlavagsgggdp
    rpgsypaqmlvdwvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pq9A (A:)
    qsgpylfhdefdgpagsapdsskwtvarareemkdptywerpenvgqyrddrqnvfldgk
    snlviraakdggtyyagkiqspwrggightwearikfdcltagcwpawwlgnqdrgeidi
    iewygngswpsattvhakangsewktrnvaldsgwhtwrcqwdetgmrfwqdyaegaqpy
    ftvaahslpdwpfndpgytvfpvlnlavagsgggdprpgsypaqmlvdwvrvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pq9B (B:)
    mahhhhhhadssrrdmplapapngqsgpylfhdefdgpagsapdsskwtvarareemkdp
    tywerpenvgqyrddrqnvfldgksnlviraakdggtyyagkiqspwrggightwearik
    fdcltagcwpawwlgnqdrgeidiiewygngswpsattvhakangsewktrnvaldsgwh
    twrcqwdetgmrfwqdyaegaqpyftvaahslpdwpfndpgytvfpvlnlavagsgggdp
    rpgsypaqmlvdwvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pq9B (B:)
    qsgpylfhdefdgpagsapdsskwtvarareemkdptywerpenvgqyrddrqnvfldgk
    snlviraakdggtyyagkiqspwrggightwearikfdcltagcwpawwlgnqdrgeidi
    iewygngswpsattvhakangsewktrnvaldsgwhtwrcqwdetgmrfwqdyaegaqpy
    ftvaahslpdwpfndpgytvfpvlnlavagsgggdprpgsypaqmlvdwvrvw