PDB entry 4ppv

View 4ppv on RCSB PDB site
Description: Crystal Structure of AtCM1 with Phenylalanine Bound in Allosteric Site
Class: isomerase
Keywords: Chorismate Mutase II, Mutase, ISOMERASE
Deposited on 2014-02-27, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.173
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate mutase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CM1, At3g29200, MXO21.4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ppva_
  • Heterogens: PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ppvA (A:)
    gshavmtlagsltgkkrvdesesltlegirnslirqedsiifgllerakycynadtydpt
    afdmdgfngslveymvkgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaa
    dsininkkiwnmyfrdlvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfq
    aspeayesaikaqdkdalmdmltfptvedaikkrvemktrtygqevkvgmeekeeeeeeg
    neshvykispilvgdlygdwimpltkevqveyllrrld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ppvA (A:)
    rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv
    kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd
    lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd
    almdmltfptvedaikkrvemktrtygqevkvvykispilvgdlygdwimpltkevqvey
    llrrld