PDB entry 4ppt

View 4ppt on RCSB PDB site
Description: Engineered Dual Specific VHH Antibody in Complex with a Nickel (II) Ion
Class: immune system
Keywords: Single domain antibody, VHH, Metalloregulation, Bispecific, Dual-Function, Protein Engineering, Affinity Control, Protein-Switch, Antibody Engineering, Nickel Binding Protein, Protein-Metal Coordination Geometry, Loop Dynamics, Protein Flexibility, Antibody-metal Complex, IMMUNE SYSTEM
Deposited on 2014-02-27, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Engineered single domain VHH antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PPT (0-120)
    Domains in SCOPe 2.07: d4ppta_
  • Heterogens: NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pptA (A:)
    qvqlvesggglvqaggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtyghwgqgtqvtvs
    s