PDB entry 4pp8

View 4pp8 on RCSB PDB site
Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D
Class: immune system
Keywords: murine nk cell ligand, rae-1 beta, nkg2d, MHC-I platform, immune system
Deposited on 2014-02-26, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nkg2-d type II integral membrane protein
    Species: Mus musculus [TaxId:10090]
    Gene: Klrk1, Nkg2d, RAE-1 BETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54709 (1-124)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4pp8a_
  • Chain 'B':
    Compound: nkg2-d type II integral membrane protein
    Species: Mus musculus [TaxId:10090]
    Gene: Klrk1, Nkg2d, RAE-1 BETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54709 (1-124)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4pp8b_
  • Chain 'C':
    Compound: Retinoic acid early-inducible protein 1-beta
    Species: Mus musculus [TaxId:10090]
    Gene: NKG2D, Raet1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pp8c_
  • Chain 'D':
    Compound: Retinoic acid early-inducible protein 1-beta
    Species: Mus musculus [TaxId:10090]
    Gene: NKG2D, Raet1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pp8d_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pp8A (A:)
    megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
    yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
    mkrav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pp8B (B:)
    megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
    yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
    mkrav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pp8C (C:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pp8C (C:)
    hslrcnltikdptpadplwyeakcfvgeililhlsninatevkkcltqplknlcqklrnk
    vsntyphlqvtmiypqsqgrtpsatwefnisdsyfftfytenmswrsandesgvimnkwk
    ddgefvkqlkflihecsqkmdeflkq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pp8D (D:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pp8D (D:)
    hslrcnltikdptpadplwyeakcfvgeililhlsniatevkkcltqplknlcqklrnkv
    sntkvdthyphlqvtmiypqsqtpsatwefnisdsyfftfytenmswrsandesgvimnk
    wkddgefvkqlkflihecsqkmdeflkqsk