PDB entry 4pp2

View 4pp2 on RCSB PDB site
Description: The crystal structure of Der p 1 allergen complexed with Fab fragment of mAb 10B9
Class: immune system
Keywords: allergen, antibody, Immune system
Deposited on 2014-02-26, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PP2 (0-210)
    Domains in SCOPe 2.07: d4pp2a1, d4pp2a2
  • Chain 'B':
    Compound: heavy chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PP2 (0-221)
  • Chain 'C':
    Compound: light chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PP2 (0-210)
    Domains in SCOPe 2.07: d4pp2c1, d4pp2c2
  • Chain 'D':
    Compound: heavy chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PP2 (0-221)
  • Chain 'E':
    Compound: Peptidase 1
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Peptidase 1
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pp2A (A:)
    diqmtqttsslsaslgdgitiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pp2C (C:)
    diqmtqttsslsaslgdgitiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.