PDB entry 4pp0

View 4pp0 on RCSB PDB site
Description: Structure of the PBP NocT-M117N in complex with pyronopaline
Class: transport protein
Keywords: PBP, class F, TRANSPORT PROTEIN
Deposited on 2014-02-26, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nopaline-binding periplasmic protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: nocT, Atu6027, AGR_pTi_67
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35120
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4pp0a_
  • Chain 'B':
    Compound: Nopaline-binding periplasmic protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: nocT, Atu6027, AGR_pTi_67
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35120
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4pp0b_
  • Heterogens: OP1, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pp0A (A:)
    mkdyksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsl
    tagrydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitp
    eqkaeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridas
    lasvsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiad
    gtvqklsqqwfgydaspkqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pp0A (A:)
    yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
    rydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitpeqk
    aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
    vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
    qklsqqwfgydasp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pp0B (B:)
    mkdyksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsl
    tagrydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitp
    eqkaeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridas
    lasvsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiad
    gtvqklsqqwfgydaspkqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pp0B (B:)
    yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
    rydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitpeqk
    aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
    vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
    qklsqqwfgydaspk