PDB entry 4poz

View 4poz on RCSB PDB site
Description: Fab fragment of Der p 1 specific antibody 10B9
Class: immune system
Keywords: antibody, allergy, Immune system
Deposited on 2014-02-26, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: light chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4POZ (0-210)
    Domains in SCOPe 2.07: d4pozc1, d4pozc2
  • Chain 'D':
    Compound: heavy chain of Fab fragment of 10B9 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4POZ (0-221)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pozC (C:)
diqmtqttsslsaslgdgitiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpytfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnr

  • Chain 'D':
    No sequence available.