SCOPe 2.05: Structural Classification of Proteins

PDB entry 4pos

View 4pos on RCSB PDB site
Description: Structure of Human Polyomavirus 9 VP1 pentamer in complex with 3'-sialyllactosamine
Class: viral protein
Keywords: jelly roll fold, capsid formation, receptor interaction, carbohydrate, sialyloligosaccharide, viral coat protein, VIRAL PROTEIN
Deposited on 2014-02-26, released 2014-04-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posa_
Chain 'B':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posb_
Chain 'C':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posc_
Chain 'D':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posd_
Chain 'E':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4pose_
Chain 'F':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90 (Start-277)
Domains in SCOPe 2.05: d4posf_
Chain 'G':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posg_
Chain 'H':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90
Domains in SCOPe 2.05: d4posh_
Chain 'I':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90 (4-End)
Domains in SCOPe 2.05: d4posi_
Chain 'J':
Compound: vp1
Species: Human Polyomavirus 9 [TaxId:943908]
Gene: gp3, vp1
Database cross-references and differences (RAF-indexed):
- Uniprot E9NQ90 (4-277)
Domains in SCOPe 2.05: d4posj_
Heterogens: CA, EDO, IPA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4posA (A:)
gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp