PDB entry 4pos

View 4pos on RCSB PDB site
Description: Structure of Human Polyomavirus 9 VP1 pentamer in complex with 3'-sialyllactosamine
Class: viral protein
Keywords: jelly roll fold, capsid formation, receptor interaction, carbohydrate, sialyloligosaccharide, viral coat protein, VIRAL PROTEIN
Deposited on 2014-02-26, released 2014-04-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'B':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
  Domains in SCOPe 2.03: d4posb_
• Chain 'C':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'D':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'E':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'F':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90 (Start-277)
• Chain 'G':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'H':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90
• Chain 'I':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90 (4-End)
• Chain 'J':
  Compound: vp1
  Species: Human Polyomavirus 9 [TaxId:943908]
  Gene: gp3, vp1
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9NQ90 (4-277)
• Heterogens: CA, EDO, IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4posB (B:)
  gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
  tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
  pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
  ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
  avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4posB (B:)
  vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
  vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
  lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
  spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
  ihtnysesqnwrglpryfnvtlrkrvvknp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.