PDB entry 4por

View 4por on RCSB PDB site
Description: Structure of Human Polyomavirus 9 VP1 pentamer in complex with 3'-sialyllactose
Class: viral protein
Keywords: jelly roll fold, capsid formation, receptor interaction, carbohydrate, sialyloligosaccharide, viral coat protein, VIRAL PROTEIN
Deposited on 2014-02-26, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pora_
  • Chain 'B':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porb_
  • Chain 'C':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porc_
  • Chain 'D':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pord_
  • Chain 'E':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pore_
  • Chain 'F':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porf_
  • Chain 'G':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porg_
  • Chain 'H':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porh_
  • Chain 'I':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pori_
  • Chain 'J':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4porj_
  • Heterogens: CA, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4porA (A:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porA (A:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4porB (B:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porB (B:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4porC (C:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porC (C:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlndmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgttl
    hmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevws
    pdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivgi
    htnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4porD (D:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porD (D:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4porE (E:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porE (E:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlndmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgttl
    hmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevws
    pdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivgi
    htnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4porF (F:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porF (F:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknpyp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4porG (G:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porG (G:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlncdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgttlhmf
    svggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevwspdp
    sknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivgihtn
    ysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4porH (H:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porH (H:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4porI (I:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porI (I:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgttl
    hmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevws
    pdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivgi
    htnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4porJ (J:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4porJ (J:)
    gvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlpty
    svaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgt
    tlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvev
    wspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdiv
    gihtnysesqnwrglpryfnvtlrkrvvknpyp