PDB entry 4poq

View 4poq on RCSB PDB site
Description: Structure of unliganded VP1 pentamer of Human Polyomavirus 9
Class: viral protein
Keywords: jelly roll fold, capsid formation, receptor interaction, carbohydrate, sialyloligosaccharide, viral coat protein, VIRAL PROTEIN
Deposited on 2014-02-26, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqa_
  • Chain 'B':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqb_
  • Chain 'C':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqc_
  • Chain 'D':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqd_
  • Chain 'E':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqe_
  • Chain 'F':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqf_
  • Chain 'G':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqg_
  • Chain 'H':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqh_
  • Chain 'I':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqi_
  • Chain 'J':
    Compound: vp1
    Species: Human Polyomavirus 9 [TaxId:943908]
    Gene: gp3, vp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poqj_
  • Heterogens: CA, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4poqA (A:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqA (A:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4poqB (B:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqB (B:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4poqC (C:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqC (C:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlndmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgttl
    hmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevws
    pdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivgi
    htnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4poqD (D:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqD (D:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknpy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4poqE (E:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqE (E:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4poqF (F:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqF (F:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknpyp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4poqG (G:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqG (G:)
    vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
    vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
    lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
    spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
    ihtnysesqnwrglpryfnvtlrkrvvknpy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4poqH (H:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqH (H:)
    ggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlpt
    ysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqg
    ttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypve
    vwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdi
    vgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4poqI (I:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqI (I:)
    ggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlpt
    ysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqg
    ttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypve
    vwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdi
    vgihtnysesqnwrglpryfnvtlrkrvvknp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4poqJ (J:)
    gshmggvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnat
    tlptysvaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgti
    pvqgttlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgk
    ypvevwspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    avdivgihtnysesqnwrglpryfnvtlrkrvvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4poqJ (J:)
    gvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlpty
    svaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgt
    tlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvev
    wspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdiv
    gihtnysesqnwrglpryfnvtlrkrvvknpyp