PDB entry 4pof

View 4pof on RCSB PDB site
Description: PfMCM N-terminal domain without DNA
Class: replication, DNA binding protein
Keywords: OB-fold, DNA replication, REPLICATION, DNA BINDING PROTEIN
Deposited on 2014-02-25, released 2014-04-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.26
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4pofa_
  • Chain 'B':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4pofb_
  • Chain 'C':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4pofc_
  • Chain 'D':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4pofd_
  • Chain 'E':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4pofe_
  • Chain 'F':
    Compound: Cell division control protein 21
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: Cdc21, PF0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3I4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4poff_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pofA (A:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofA (A:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pofB (B:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofB (B:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pofC (C:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofC (C:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pofD (D:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofD (D:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pofE (E:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofE (E:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pofF (F:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvskei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pofF (F:)
    svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
    vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
    givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
    vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
    frkilevnhiepvsk