PDB entry 4pn3

View 4pn3 on RCSB PDB site
Description: Crystal structure of 3-hydroxyacyl-CoA-dehydrogenase from Brucella melitensis
Class: oxidoreductase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2014-05-22, released 2014-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (3-7)
    Domains in SCOPe 2.05: d4pn3a_
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (3-7)
    Domains in SCOPe 2.05: d4pn3b_
  • Chain 'C':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (4-7)
    Domains in SCOPe 2.05: d4pn3c_
  • Chain 'D':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (2-7)
    Domains in SCOPe 2.05: d4pn3d_
  • Chain 'E':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (6-7)
    Domains in SCOPe 2.05: d4pn3e_
  • Chain 'F':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (4-7)
    Domains in SCOPe 2.05: d4pn3f_
  • Chain 'G':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (7)
    Domains in SCOPe 2.05: d4pn3g_
  • Chain 'H':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella melitensis 64/150 [TaxId:1160220]
    Gene: C045_02890
    Database cross-references and differences (RAF-indexed):
    • Uniprot N7K0F6 (8-262)
      • expression tag (3-7)
    Domains in SCOPe 2.05: d4pn3h_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pn3A (A:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3A (A:)
    hhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarf
    qrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinl
    igtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpv
    arelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhive
    nqmlngevirldgalrmaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pn3B (B:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3B (B:)
    hhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarf
    qrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinl
    igtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpv
    arelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhive
    nqmlngevirldgalrmaak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pn3C (C:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3C (C:)
    hhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfq
    rtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinli
    gtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpva
    relarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhiven
    qmlngevirldgalrmaak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pn3D (D:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3D (D:)
    hhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasar
    fqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisin
    ligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlp
    varelarhgirvmtiapgifktalgasvpfpprlgepaeyaalvrhivenqmlngevirl
    dgalrmaak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pn3E (E:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3E (E:)
    hhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfqrt
    dvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinligt
    fnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpvare
    larhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhivenqm
    lngevirldgalrmaak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pn3F (F:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3F (F:)
    hhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfq
    rtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinli
    gtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpva
    relarhgirvmtiapgifktppqevqdalgasvpfpprlgepaeyaalvrhivenqmlng
    evirldgalrmaak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4pn3G (G:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3G (G:)
    hmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfqrtd
    vasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinligtf
    nmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpvarel
    arhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhivenqml
    ngevirldgalrmaak
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4pn3H (H:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pn3H (H:)
    hhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarf
    qrtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinl
    igtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpv
    arelarhgirvmtiapgifkdalgasvpfpprlgepaeyaalvrhivenqmlngevirld
    galrmaak