PDB entry 4pmu

View 4pmu on RCSB PDB site
Description: Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211)
Class: hydrolase
Keywords: glycoside hydrolase, HYDROLASE
Deposited on 2014-05-22, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmua_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmub_
  • Chain 'C':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmuc_
  • Chain 'D':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmud_
  • Chain 'E':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmue_
  • Chain 'F':
    Compound: Endo-1,4-beta-xylanase A
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynA, XAC4249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pmuf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pmuA (A:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pmuA (A:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pmuB (B:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pmuC (C:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pmuD (D:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pmuD (D:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pmuE (E:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pmuE (E:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pmuF (F:)
    tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
    saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
    ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
    wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
    ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
    rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pmuF (F:)
    slkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdfs
    aadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagry
    tgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfnaw
    rpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmitel
    didvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfwr
    krdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa