PDB entry 4pmf
View 4pmf on RCSB PDB site
Description: Human transthyretin (TTR) complexed with curcumin
Class: Thyroid hormone-binding protein
Keywords: Human transthyretin (TTR) complex, hydrophobic ligand solubilization., Thyroid hormone-binding protein
Deposited on
2014-05-21, released
2014-10-08
The last revision prior to the SCOPe 2.06 freeze date was dated
2014-10-29, with a file datestamp of
2014-10-24.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.178
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Transthyretin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4pmfa_ - Chain 'B':
Compound: Transthyretin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4pmfb_ - Heterogens: CUR, NA, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4pmfA (A:)
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4pmfB (B:)
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp