PDB entry 4pma

View 4pma on RCSB PDB site
Description: Crystal structure of CTX-M-14 S70G:S237A:R276A beta-lactamase at 1.39 Angstroms resolution
Class: hydrolase
Keywords: Class A beta-lactamase, HYDROLASE
Deposited on 2014-05-20, released 2014-12-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:1125630]
    Gene: KPHS_p301310
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8XD06 (0-262)
      • engineered mutation (44)
      • engineered mutation (211)
      • engineered mutation (248)
    Domains in SCOPe 2.08: d4pmaa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pmaA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgagdygttndiaviwpqgraplvlvtyftq
    pqqnaesradvlasaariiaegl